Protein coding transcript 111071

• Transcript: Ll_transcript_297406
• CDS coordinates: 110-637 (+)
• Peptide sequence: MAFWRSLAFSSLLALLFIHGSHSFYLPGVAPQDFNKGDLLQVKVNKLTSIKTQLPYTYYSLPYCSPNKIQDSAENLGEVLRGDRIENSLYAFKMREPQMCNVVCNRKLDAKTAKEFKEKINDEYRVNMILDNLPLVVPIKRNDQDSTVYQLGFHVGLKGQYSGVWLLFYSTCLLL*
• ORF Type: complete

Annotations of Ll_transcript_297406

• Blastp: Transmembrane 9 superfamily member 8 from Arabidopsis with 78.71% of identity
• Blastx: Transmembrane 9 superfamily member 8 from Arabidopsis with 79.73% of identity
• Eggnog: transmembrane 9 superfamily(ENOG410XPIW)
• Kegg: Link to kegg annotations (AT5G10840)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437804.1)
• Pfam: Endomembrane protein 70 (PF02990.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;