Protein coding transcript 111082

• Transcript: Ll_transcript_297394
• CDS coordinates: 1-663 (+)
• Peptide sequence: VAPQDFQKGDLLQVKVNKLTSIKTQLPYTYYSLPYCSPAKIQDSAENLGEVLRGDRIENSLYVFKMREPQMCNVVCNRKLDAKAAKEFKEKINDEYRVNMILDNLPLVVPIKMNNQDLTVYQLGFHVGLKGQYTGNKEEKFFIHNHLAFTVKYHKDIQTESARIVGFEVKPFRLLFCSLSLLLFHFIYLLYLFSTIVGISCMGCHLILVHLFVPVVIFHM*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_297394

• Blastp: Transmembrane 9 superfamily member 8 from Arabidopsis with 75.57% of identity
• Blastx: Transmembrane 9 superfamily member 8 from Arabidopsis with 76.44% of identity
• Eggnog: transmembrane 9 superfamily(ENOG410XPIW)
• Kegg: Link to kegg annotations (AT5G10840)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417202.1)
• Pfam: Endomembrane protein 70 (PF02990.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;