Protein coding transcript 111095

• Transcript: Ll_transcript_297246
• CDS coordinates: 267-746 (+)
• Peptide sequence: MSGIARGRLTEERKSWRKNHPHGFVAKPETLPDGTVNLMVWHCTIPGKAGTDWEGGYFPLTLNFSEDYPSKPPKCKLPQGFFHPNVYPSGTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADPAQTEGYHLFIQDAVEYKRRVRQQAKQYPAIL*
• ORF Type: complete

Annotations of Ll_transcript_297246

• Blastp: SUMO-conjugating enzyme SCE1 from Arabidopsis with 88.61% of identity
• Blastx: SUMO-conjugating enzyme SCE1 from Arabidopsis with 88.61% of identity
• Eggnog: ubiquitin-conjugating enzyme(COG5078)
• Kegg: Link to kegg annotations (AT3G57870)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446820.1)
• Pfam: Ubiquitin-conjugating enzyme (PF00179.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;