Protein coding transcript 1111

• Transcript: Ll_transcript_382645
• CDS coordinates: 2-496 (+)
• Peptide sequence: LNQISSMDSDDLDQPTSEGRSKVIITRSYECNFCKRGFSNAQALGGHMNIHRKDKEKLKQTSTLSNQFSLDNNPQKVPPLLPWNMSLKDGVSSRDETHVVQIKQLPLFDDSKKPQSEALREINDESETRVLPCSQGSSSELDLELRLGLDPEDSSATMGTRKFF*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_382645

• Blastp: Transcriptional regulator TAC1 from Arabidopsis with 77.14% of identity
• Blastx: Transcriptional regulator TAC1 from Arabidopsis with 77.14% of identity
• Eggnog: ZnF_C2H2(ENOG4111ECK)
• Kegg: Link to kegg annotations (AT3G09290)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448332.1)
• Pfam: C2H2-type zinc finger (PF13912.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;