Protein coding transcript 111176

• Transcript: Ll_transcript_448112
• CDS coordinates: 241-1086 (+)
• Peptide sequence: MDSFEPDGNGNGNGNNNGNGNEESLPPPPPIVPPDVVPVKAEDVLTVPAEPVKKKASRFPIARRGLGSKGMKISLQTNHFKVNVNTNDGYFFHYSVAFSYEDGRPVEGKGVGRKIMDRVQETYDSELNGKDFAYDGEKSLFTIGSLPRNKLEFEVVLENVTSNRNNNGNCSPDDGHGDNDSDKKRIRRPYRAKTFKVEISYAAKIPMQAIANALRGQESENFQEAIRVLDIVLRQHAAKQGCLLVRQSFFHNDPNNFADVGGGVLGCRGFHSSFRTTQSGLS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_448112

• Blastp: Protein argonaute 4 from Arabidopsis with 68.7% of identity
• Blastx: Protein argonaute 4 from Arabidopsis with 68.7% of identity
• Eggnog: eukaryotic translation initiation factor 2c(ENOG410XP07)
• Kegg: Link to kegg annotations (AT2G27040)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440717.1)
• Pfam: N-terminal domain of argonaute (PF16486.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;