Protein coding transcript 111193

• Transcript: Ll_transcript_446495
• CDS coordinates: 181-627 (+)
• Peptide sequence: MSSQSGSSRRSFSYAKRTSESAVPHSNSRRSFSYSRLPIGLTGERTVKSLRLSKALTVPDTTTVYEACRRMAARRVDALLLTDANAMLCGILTDKDIVTRVIGQDIKPEDTLVSKIMTKNPVFVLSESLAVEALQKMVQGKFRHLPVVE
• ORF Type: 3prime_partial

Annotations of Ll_transcript_446495

• Blastp: CBS domain-containing protein CBSCBSPB1 from Arabidopsis with 68.35% of identity
• Blastx: CBS domain-containing protein CBSCBSPB1 from Arabidopsis with 80.33% of identity
• Eggnog: Catalyzes the conversion of inosine 5'-phosphate (IMP) to xanthosine 5'-phosphate (XMP), the first committed and rate- limiting step in the de novo synthesis of guanine nucleotides, and therefore plays an important role in the regulation of cell growth (By similarity)(COG0517)
• Kegg: Link to kegg annotations (AT5G63490)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430760.1)
• Pfam: CBS domain (PF00571.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;