| Transcript | Ll_transcript_447628 |
|---|---|
| CDS coordinates | 1-366 (+) |
| Peptide sequence | LFVIASLRLLLPSIFSSFPIIESWIFNHWDLKTSNLLLNNRGELKICDFGLARQYGSPLKPYTQLVVTLWYRAPELLLGAKQYSTAIDMWSLGCIMAELLSKEPLFNGRTEFDQLDKIFRIL |
| ORF Type | internal |
| Blastp | - |
|---|---|
| Blastx | Cyclin-dependent kinase G-2 from Oryza sativa with 90.53% of identity |
| Eggnog | Cyclin-dependent kinase(ENOG410XQ50) |
| Kegg | Link to kegg annotations (4336224) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019463653.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer