| Transcript | Ll_transcript_447166 |
|---|---|
| CDS coordinates | 147-560 (+) |
| Peptide sequence | MVETAKKTGIQGRIVNVTSGIHGWYSGDMISYLSLISCNKSDYDATRAYALSKLANLYHTTELARRLQQMEANVTVNCVHPGVVRTRLTREREGLLTDLVFFLGSKLLKTIPQVKYKIGLCILYHLNLSYLSSLIRT* |
| ORF Type | complete |
| Blastp | - |
|---|---|
| Blastx | Short-chain dehydrogenase TIC 32, chloroplastic from Arabidopsis with 38.4% of identity |
| Eggnog | Dehydrogenase reductase(COG1028) |
| Kegg | Link to kegg annotations (AT4G23430) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019420506.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer