Transcript | Ll_transcript_447175 |
---|---|
CDS coordinates | 147-560 (+) |
Peptide sequence | MVETAKKTGIQGRIVNVTSGIHGWYSGDMISYLSLISCNKSDYDATRAYALSKLANLYHTTELARRLQQMEANVTVNCVHPGVVRTRLTREREGLLTDLVFFLGSKLLKTIPQVKYKIGLCILYHLNLSYLSSLIRT* |
ORF Type | complete |
Blastp | - |
---|---|
Blastx | Short-chain dehydrogenase TIC 32, chloroplastic from Arabidopsis with 38.4% of identity |
Eggnog | Dehydrogenase reductase(COG1028) |
Kegg | Link to kegg annotations (AT4G23430) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019420506.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer