Protein coding transcript 111441

• Transcript: Ll_transcript_446994
• CDS coordinates: 82-810 (+)
• Peptide sequence: MASLWRVATKFSLLTAAVGGGTTAALIASSDDPKTALKLATTVPRRLFRDAVTAANIAFDYEYSLWGVPEGSTEWEKIKHEVHLRSAQKLQELCFKNGGIYIKLGQHLGQLEYLVPEEYVTTMRNSMLNRCPVSSYEQICEVFEKEFGETPDKVFAEFDPVPIASASLAQVHVAHTHDGKKVAVKVQHTHLTDTAAADNAIVEFIVNTLHRFFPNFDYRWLIDEINDSLPKASYVGILPPGY*
• ORF Type: complete

Annotations of Ll_transcript_446994

• Blastp: Putative ABC1 protein At2g40090 from Arabidopsis with 76.42% of identity
• Blastx: Putative ABC1 protein At2g40090 from Arabidopsis with 74.92% of identity
• Eggnog: Required, probably indirectly, for the hydroxylation of 2-octaprenylphenol to 2-octaprenyl-6-hydroxy-phenol, the fourth step in ubiquinone biosynthesis (By similarity)(COG0661)
• Kegg: Link to kegg annotations (AT2G40090)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417870.1)
• Pfam: ABC1 family (PF03109.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;