Transcript | Ll_transcript_447806 |
---|---|
CDS coordinates | 49-405 (+) |
Peptide sequence | MGEAKGITVPESVLKKQKREQEWALAKTKEAEADKKKRVLNRKLIFNRAKQYAKEYSEQEKELIRLKREAKLRGGFYVDPEAKLLFIIRIRGINGMDPNTRKILHFPTQLYPFIHFAF* |
ORF Type | complete |
Blastp | 60S ribosomal protein L7-4 from Arabidopsis with 73.83% of identity |
---|---|
Blastx | 60S ribosomal protein L7-4 from Arabidopsis with 73.83% of identity |
Eggnog | ribosomal large subunit biogenesis(COG1841) |
Kegg | Link to kegg annotations (AT3G13580) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019426908.1) |
Pfam | Ribosomal L30 N-terminal domain (PF08079.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer