Protein coding transcript 111473

• Transcript: Ll_transcript_447806
• CDS coordinates: 49-405 (+)
• Peptide sequence: MGEAKGITVPESVLKKQKREQEWALAKTKEAEADKKKRVLNRKLIFNRAKQYAKEYSEQEKELIRLKREAKLRGGFYVDPEAKLLFIIRIRGINGMDPNTRKILHFPTQLYPFIHFAF*
• ORF Type: complete

Annotations of Ll_transcript_447806

• Blastp: 60S ribosomal protein L7-4 from Arabidopsis with 73.83% of identity
• Blastx: 60S ribosomal protein L7-4 from Arabidopsis with 73.83% of identity
• Eggnog: ribosomal large subunit biogenesis(COG1841)
• Kegg: Link to kegg annotations (AT3G13580)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426908.1)
• Pfam: Ribosomal L30 N-terminal domain (PF08079.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;