Protein coding transcript 111490

• Transcript: Ll_transcript_448215
• CDS coordinates: 301-1542 (+)
• Peptide sequence: MIEIKKGGYDAKTFAVKLREMVTLMEQRTRMAKIQEYLYRHVASSSIPKQLHCLAMRLANEHSNNAAARLQLPSAELVPALVDNTYFHFVLASDNVLAASAVATSLVRNCLRPQNVVLHIITDRKTYYPMQAWFSLHSLLPAIIEVKALYHFDWFTKGKVPVLEAMEKDQKVRSRFRGGSSAIVANTTEKPNVIAAKLQALSPKYNSVMNHIRIHLPELFPSLNKVVFLDDDIVVQTDLTPLWDIDMNGKVNGAVETCGGEDKFVMSKRLKSYLNFSHPLISKSFNPNECAWAYGMNIFDLAAWRKTNISLTYHYWVEQNVKSDLSLWQLGTLPPGLIAFHDHVHIIDPFWHMLGLGYQENTSVAGAESAGVIHFNGRAKPWLELAFPQLRPLWTKYVDFSDKFIKSCRIRAS*
• ORF Type: complete

Annotations of Ll_transcript_448215

• Blastp: Probable galacturonosyltransferase 12 from Arabidopsis with 81.84% of identity
• Blastx: Probable galacturonosyltransferase 12 from Arabidopsis with 80.41% of identity
• Eggnog: Galacturonosyltransferase(ENOG410Y9J4)
• Kegg: Link to kegg annotations (AT5G54690)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020235268.1)
• Pfam: Glycosyl transferase family 8 (PF01501.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;