Protein coding transcript 111498

• Transcript: Ll_transcript_448208
• CDS coordinates: 507-1853 (+)
• Peptide sequence: MQQHISPSLCYVTLLQAKGLKEFIKVKVGSRRISYKMLFFSLLFSTFLLKFVFVLTSVDDIDGENKCSTVGCLRKKLRPEILRRSPDPESNIPEVIYQTLLEPLSKDELQGRSDIPQTLEEFMIEMEKGEYDAKTFAVKLREMVTLMEQRTRMAKIHEYLYRHLASNSIPKQLHCLTLRLANEHSNNAGVRLQLPHAELVPALVDNSYFHFVLASDNVLAASVVAKSLIRNCLRSQKVVLHIITDKKTYYPMQVWFSKHRVSPGIIEVKALDHFDWLTKGKVPVVEAMEKDQKMQSQFRGGSSTIVSNTIKKPNFIAAKLRALGPKYSVMNHIRIHLPELFPSLNKVVFLDDDIVVQTDLTPLWDINMNGKVIGAVETCSGGDKFVMSKRLKSYLNFSHPLIYENFDPNECAWAYGMNIFDLEAWRKTNISLKYHYWVEQVYSSTILH*
• ORF Type: complete

Annotations of Ll_transcript_448208

• Blastp: Probable galacturonosyltransferase 12 from Arabidopsis with 70.76% of identity
• Blastx: Probable galacturonosyltransferase 12 from Arabidopsis with 71.49% of identity
• Eggnog: Galacturonosyltransferase(ENOG410Y9J4)
• Kegg: Link to kegg annotations (AT5G54690)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019457435.1)
• Pfam: Glycosyl transferase family 8 (PF01501.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;