Transcript | Ll_transcript_448211 |
---|---|
CDS coordinates | 301-1302 (+) |
Peptide sequence | MIEIKKGGYDAKTFAVKLREMVTLMEQRTRMAKIQEYLYRHVASSSIPKQLHCLAMRLANEHSNNAAARLQLPSAELVPALVDNTYFHFVLASDNVLAASAVATSLVRNCLRPQNVVLHIITDRKTYYPMQAWFSLHPLSPAIIEVKALHHFDWFTKGKVPVLEAMEKDQQVRSQFRGGSSSIVANTSEKPNVIAAKLQALSPTYNSVMNHIRIHLPELFPGLDKIVFLDDDIVVQTDLSPLWDIDMDGKVNGAVETCTGEDKFVMSKRLKSYLNFSHPLISKNFDPNECAWAYGMNIFDLEAWRNTNISLIYHNWVEQNIKSDLSLWQLGTLP |
ORF Type | 3prime_partial |
Blastp | Probable galacturonosyltransferase 12 from Arabidopsis with 81.74% of identity |
---|---|
Blastx | Probable galacturonosyltransferase 12 from Arabidopsis with 80% of identity |
Eggnog | Galacturonosyltransferase(ENOG410Y9J4) |
Kegg | Link to kegg annotations (AT5G54690) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_015936483.1) |
Pfam | Glycosyl transferase family 8 (PF01501.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer