Protein coding transcript 111524

• Transcript: Ll_transcript_446933
• CDS coordinates: 253-1155 (+)
• Peptide sequence: MGGHDYFNATLPDEVVIEIFRRLDFKLKREVCPLVCHRWLRVDRLTRSTLKLGAAGSSDLFLRTLATRFPNATNIHVDERFATSPPHDTWERRSRDNLKVSSGESCGSVGNVDSPCLSDAGLAAIGEGFPRLEILNLIWCSNVTSDGLASLAHKCTSLKSLDLQGCYVGDQGLAAVGQCCKQLEDLNLRFCEGLTDTGLIELALGVGKSLKSLGVAACANITDSSMEAVGSHCRSLESLSLDSEFIHNQGVLAVARGCPRLKVLKLQCINVNDDALKAVGGTCLSLMSLALYSFQRFTDK*
• ORF Type: complete

Annotations of Ll_transcript_446933

• Blastp: F-box/LRR-repeat protein 4 from Arabidopsis with 58.71% of identity
• Blastx: F-box/LRR-repeat protein 4 from Arabidopsis with 58.71% of identity
• Eggnog: F-box and leucine-rich repeat protein(ENOG410XQ54)
• Kegg: Link to kegg annotations (AT4G15475)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419747.1)
• Pfam: F-box domain (PF00646.32)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;