Transcript | Ll_transcript_446944 |
---|---|
CDS coordinates | 1-528 (+) |
Peptide sequence | DSSMEAVGSHCRSLENLSLDSEFIHNQGVLAVARGCPRLKVLKLQCINVNDDALKAVGGTCLSLMSLALYSFQRFTDKGFIAIGKGSKNLKFLTLSDCYFLSDKGMEAIATGCEELTHLEINGCHDIGTPGLQAVGQACRHLTELALLYCQRIDDLGLLQVGQGCKFLRTLHLVDC |
ORF Type | internal |
Blastp | F-box/LRR-repeat protein 4 from Arabidopsis with 66.48% of identity |
---|---|
Blastx | F-box/LRR-repeat protein 4 from Arabidopsis with 66.48% of identity |
Eggnog | F-box and leucine-rich repeat protein(ENOG410XQ54) |
Kegg | Link to kegg annotations (AT4G15475) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019419747.1) |
Pfam | Leucine Rich repeat (PF13516.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer