Protein coding transcript 1116

• Transcript: Ll_transcript_395991
• CDS coordinates: 1-342 (+)
• Peptide sequence: HLYEQCREFLIQVQHIAKDRGEKCPTKVTNQVFRFAKKAGASYINKPKMRHYVHCYALHCLDEEVSNELRRAFKERGENVGAWRQACYKPLVEIASLQGWDIDAIFNAHPRLSI
• ORF Type: internal

Annotations of Ll_transcript_395991

• Blastp: Protein UNIFOLIATA from Pisum with 93.86% of identity
• Blastx: Protein UNIFOLIATA from Pisum with 93.86% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458009.1)
• Pfam: DNA Binding Domain (C-terminal) Leafy/Floricaula (PF17538.1)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;