Transcript | Ll_transcript_446041 |
---|---|
CDS coordinates | 672-1154 (+) |
Peptide sequence | MGYVEDGDAPLDYASFQIFPNQNRYEAFVCKGKLSEKIAAGQLEHLLPHVPALNDLYAKGSDANFDLKLPENLHGAEWFSKVTVKRFLHVVTSPDLVNVINTIMDEMYQLEDSKKFHVSLYGKPQVNNVSSETSKYVPETIVLLLADRDWLHPLLRFLKL* |
ORF Type | complete |
Blastp | COP1-interacting protein 7 from Arabidopsis with 33.98% of identity |
---|---|
Blastx | COP1-interacting protein 7 from Arabidopsis with 33.98% of identity |
Eggnog | NA(ENOG4111427) |
Kegg | Link to kegg annotations (AT4G27430) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019430947.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer