Protein coding transcript 11169

• Transcript: Ll_transcript_335428
• CDS coordinates: 425-847 (+)
• Peptide sequence: MCITGTESPVIVVLSGSMEPGFRRGDILFLSMSKDPIRAGDIIVFNIDGREIPIVHRVIQVHEPNNVKETFMLTKGDNNPMDDRVLYNYGQNWLQRHHIMGRAVGILPYAGWMTIIMTENPIVKYVLIGTLTLLILTTKE*
• ORF Type: complete

Annotations of Ll_transcript_335428

• Blastp: Signal peptidase complex catalytic subunit SEC11C from Rattus with 56.74% of identity
• Blastx: Signal peptidase complex catalytic subunit SEC11C from Rattus with 60.27% of identity
• Eggnog: Signal peptidase i(COG0681)
• Kegg: Link to kegg annotations (266758)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416141.1)
• Pfam: Peptidase S24-like (PF00717.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;