Transcript | Ll_transcript_335419 |
---|---|
CDS coordinates | 42-584 (+) |
Peptide sequence | MGCFGNVVDSVKSFQFRQTLSQLITLGLIVSTALILWKGLMCITGTESPVIVVLSGSMEPGFRRGDILFLSMSKDPIRAGDIIVFNIDGREIPIVHRVIQVHEPNNVKETFMLTKGDNNPMDDRVLYNYGQNWLQRHHIMGRAVGILPYAGWMTIIMTENPIVKYVLIGTLTLLILTTKE* |
ORF Type | complete |
Blastp | Signal peptidase complex catalytic subunit SEC11C from Pongo with 52.84% of identity |
---|---|
Blastx | Signal peptidase complex catalytic subunit SEC11C from Pongo with 55.03% of identity |
Eggnog | Signal peptidase i(COG0681) |
Kegg | Link to kegg annotations (100174381) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019416141.1) |
Pfam | Peptidase S24-like (PF00717.22) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer