Protein coding transcript 111793

• Transcript: Ll_transcript_446438
• CDS coordinates: 1756-2328 (+)
• Peptide sequence: MSPKISDFGMARMVTIDQEQGRTNRVVGTYGYMSPEYAMLGRFSEKSDIFSFGVMVLEIISSRKHSTSYQPYYVDGLLSHAWKQWRDGAPFEILDPSLHESCSQTEVMKCIQIGLLCVQEIPDDRPLMAEVVSYLSSPSIELPFPCEPAFFIHGGMEINMVEMELELDCVAKNITPFSINEMSISESLPR*
• ORF Type: complete

Annotations of Ll_transcript_446438

• Blastp: Cysteine-rich receptor-like protein kinase 10 from Arabidopsis with 46.32% of identity
• Blastx: Cysteine-rich receptor-like protein kinase 10 from Arabidopsis with 52.48% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT4G23180)
• CantataDB: Link to cantataDB annotations (CNT0000159)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441532.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;