Transcript | Ll_transcript_446452 |
---|---|
CDS coordinates | 1681-2253 (+) |
Peptide sequence | MSPKISDFGMARMVTIDQEQGRTNRVVGTYGYMSPEYAMLGRFSEKSDIFSFGVMVLEIISSRKHSTSYQPYYVDGLLSHAWKQWRDGAPFEILDPSLHESCSQTEVMKCIQIGLLCVQEIPDDRPLMAEVVSYLSSPSIELPFPCEPAFFIHGGMEINMVEMELELDCVAKNITPFSINEMSISESLPR* |
ORF Type | complete |
Blastp | Cysteine-rich receptor-like protein kinase 10 from Arabidopsis with 46.32% of identity |
---|---|
Blastx | Cysteine-rich receptor-like protein kinase 10 from Arabidopsis with 56.15% of identity |
Eggnog | Serine Threonine protein kinase(COG0515) |
Kegg | Link to kegg annotations (AT4G23180) |
CantataDB | Link to cantataDB annotations (CNT0000159) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019441532.1) |
Pfam | Protein kinase domain (PF00069.24) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer