Protein coding transcript 111821

• Transcript: Ll_transcript_448240
• CDS coordinates: 2-424 (+)
• Peptide sequence: NVVIEQSFGAPKVTKDGVIVAKSIEFKNKVKNIGASLVKQVANATNDVAGDGTTCATVLTRAILTEGCKSVAAGMNAMDLRRGINLAVDAVVTNLKSRARRISTSEEIAQVGTISANGEREIGELIAKAMEKVGKEGVITI
• ORF Type: internal

Annotations of Ll_transcript_448240

• Blastp: Chaperonin CPN60-2, mitochondrial from Cucurbita with 92.91% of identity
• Blastx: Chaperonin CPN60-2, mitochondrial from Cucurbita with 92.91% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0001044)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014514640.1)
• Pfam: TCP-1/cpn60 chaperonin family (PF00118.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;