Protein coding transcript 111898

• Transcript: Ll_transcript_446544
• CDS coordinates: 1314-2009 (+)
• Peptide sequence: MYVLEGVTPCIQAMQLCAGDTVTFSRIDPGGKLVMGFRKASNLIDTQDASTSANCNGISTKGTTNSGGTENLPPGSSFADLLQMIKGNGEPHLNGHLEHFHLGAGAAGLLKEENCEKTNNHSPQQPIPVSEKRTRNIGPKSKRFCIDNEDAMELRLTWEEAQDLLRPPPSVQPSIFTIEDQVIEEYEEPPVFGKRTIFCACSSGGKEQWAQCDDCSKWRRLPVDAVLPPKWT
• ORF Type: 3prime_partial

Annotations of Ll_transcript_446544

• Blastp: B3 domain-containing transcription repressor VAL2 from Arabidopsis with 50.43% of identity
• Blastx: B3 domain-containing transcription repressor VAL2 from Arabidopsis with 56.68% of identity
• Eggnog: B3 domain-containing protein(ENOG410Z235)
• Kegg: Link to kegg annotations (AT4G32010)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439590.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;