Transcript | Ll_transcript_445713 |
---|---|
CDS coordinates | 2442-2858 (+) |
Peptide sequence | MFGDYPSSMRTRVGDRLPKFSEAESALLKGSLDFVGINHYTTFYARDNYTNFLGIILHDAVSDSGTITLRKYLTQFSHGVKGYIIFLISYRSDLNLGSFALSLIVYLSFGFSFQRSKIYWRKGKFYMVVYSTTRHEKLN |
ORF Type | 3prime_partial |
Blastp | - |
---|---|
Blastx | Beta-glucosidase 40 from Arabidopsis with 74.84% of identity |
Eggnog | beta-glucosidase(COG2723) |
Kegg | Link to kegg annotations (AT1G26560) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019424172.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer