Protein coding transcript 111922

• Transcript: Ll_transcript_445715
• CDS coordinates: 2714-3340 (+)
• Peptide sequence: MFGDYPSSMRSRVGDRLPKFSEAEAALLKGSLDFVGINHYTTYYTSDNSTNVVGTVLHDAFADSGTISLPFKGTKPIGERANSIWLYIVPQGMRSLMNYINKKYGNPPVIITENGMDDPNSPLISVKDALKDEKRIRYFTGYLSALLDSIKDGCNVKGHFVWSVLDNWEWNAGYSSRFGLYYVDYKDNLKRYPKQSVEWFKNFLKAKK*
• ORF Type: complete

Annotations of Ll_transcript_445715

• Blastp: Beta-glucosidase 40 from Arabidopsis with 74.88% of identity
• Blastx: Beta-glucosidase 40 from Arabidopsis with 74.7% of identity
• Eggnog: beta-glucosidase(COG2723)
• Kegg: Link to kegg annotations (AT1G26560)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424171.1)
• Pfam: Glycosyl hydrolase family 1 (PF00232.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;