Transcript | Ll_transcript_446783 |
---|---|
CDS coordinates | 111-1394 (+) |
Peptide sequence | MIKEREQKKPFVWLIGNYAAELKFLLTTLLLLCTFVTFFQFIPSRFSISASDLRVCISRVSQVITPTPPSSISHLTTTNTTTTLSPPPPPPPSPSQEKLLPNGILKRVFNPYGSAAYNFVNMGAYRGGLKTFAIIGISSKPLHVYSKPTYECHWEQNINPNDTTTNMSKPMSTVGYKILPDWGYGRVYTVVIVNCTFSEPINNDNKGGKLILYASTSGGGDTNFNTTDKFEVLTEQPGTLDVSVFTSKPKYDYFYCGSSLFGNLSPQRIREWIAYHVKFFGPSSHFVIHDAGGVHEKVLEVLKPWMDLGYVTLQDIRDQERFDGYYHNQFMVLNDCLHRYKFMGKWMFFFDVDEYIYVPPKSTIKTVLDSLQEYNQFTIEQMPMSNKLCHTDDYGKSYRYIAFIAPFLFSCDFAKYFLLTHFVASLD* |
ORF Type | complete |
Blastp | Galactan beta-1,4-galactosyltransferase GALS3 from Arabidopsis with 56.83% of identity |
---|---|
Blastx | Galactan beta-1,4-galactosyltransferase GALS3 from Arabidopsis with 56.72% of identity |
Eggnog | UPF0392 protein(ENOG410Z7P2) |
Kegg | Link to kegg annotations (AT4G20170) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019434966.1) |
Pfam | Glycosyltransferase family 92 (PF01697.26) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer