Protein coding transcript 112187

• Transcript: Ll_transcript_446750
• CDS coordinates: 1-612 (+)
• Peptide sequence: KQSQDGRDEELIALRVELQNLKDAASVAIEQQQEAESEAKSLRTMTQRMILTQEEMEELVLKRCWLARYWGLAVKHGLCPDTAPSKHGYWSSLAPLPFEVVTSAGQKAREKPLDKNADNPYRSNPIRDLNDLTGEGSIESMLSVEMGLRELASLKVEDAVVLALAQYRHPNLDSKYPGDPKFVEALELSDEEVEDVVFKEAWLT
• ORF Type: internal

Annotations of Ll_transcript_446750

• Blastp: Coiled-coil domain-containing protein SCD2 from Arabidopsis with 66.99% of identity
• Blastx: Coiled-coil domain-containing protein SCD2 from Arabidopsis with 66.99% of identity
• Eggnog: NA(ENOG410ZI6D)
• Kegg: Link to kegg annotations (AT3G48860)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462869.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;