| Transcript | Ll_transcript_445494 |
|---|---|
| CDS coordinates | 928-1251 (+) |
| Peptide sequence | MYVTKHSTEKMGKEETVALLTTKNEEENENNENNGVAPLDSAFLIQLKKVGSMAAPMVAVTVSQYLLQVVSLMMVGHLGALVSFSGVAIASSFAEVTGFSVLLGMAGA |
| ORF Type | 3prime_partial |
| Blastp | Protein DETOXIFICATION 3 from Arabidopsis with 60.94% of identity |
|---|---|
| Blastx | Protein DETOXIFICATION 3 from Arabidopsis with 60.94% of identity |
| Eggnog | Mate efflux family protein(COG0534) |
| Kegg | Link to kegg annotations (AT2G04050) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019456803.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer