Protein coding transcript 1122

• Transcript: Ll_transcript_435547
• CDS coordinates: 183-497 (+)
• Peptide sequence: MNKLNMVGVKNNNVIMKRNGQGKRNKKEIKVTYISSPMMFKTSASNFRALVQELTGQDSNVAEMFMEVPNEVVGFVHNKGLMQERSEAYLTDYIEFDLLRFDML*
• ORF Type: complete

Annotations of Ll_transcript_435547

• Blastp: Sigma factor binding protein 1, chloroplastic from Arabidopsis with 52.83% of identity
• Blastx: Sigma factor binding protein 1, chloroplastic from Arabidopsis with 69.7% of identity
• Eggnog: Sigma factor binding protein(ENOG410ZFI0)
• Kegg: Link to kegg annotations (AT3G56710)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_006578424.1)
• Pfam: VQ motif (PF05678.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;