Protein coding transcript 112287

• Transcript: Ll_transcript_447560
• CDS coordinates: 647-1132 (+)
• Peptide sequence: MIKRILDPNPKTRITMAMIKENEWFKNGYTPVNPEDDEEDVYIDDEALSIHEVALESEQRSPKSPTLINAFQLIGMSSCLDLSGFFEKEDVSERKIRFTSHHSPKDLIEKIEDIVTEMGFIVQKRNGMVRNVAYVYKSFFISHVSNTLANEQSIRFAKISL*
• ORF Type: complete

Annotations of Ll_transcript_447560

• Blastp: CBL-interacting serine/threonine-protein kinase 17 from Arabidopsis with 56.06% of identity
• Blastx: CBL-interacting serine/threonine-protein kinase 1 from Arabidopsis with 74.15% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT1G48260)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415917.1)
• Pfam: NAF domain (PF03822.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;