Protein coding transcript 112291

• Transcript: Ll_transcript_447540
• CDS coordinates: 3-614 (+)
• Peptide sequence: CHNKGVYHRDLKLENVLVDAKGNIKITDFNLSALPQNFRADGLLHTTCGSPNYVAPEILANRGYDGATSDTWSCGVILYVILTGYLPFDDRNLAVLYQKIFKGDVQIPKWLSPGAQNMIKRILDPNPKTRITMAMIKENEWFKNGYTPVNPEDDEEDVYIDDEALSIHEVALESEQRSPKSPTLINAFQLIGMSSCLDLSGFF*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_447540

• Blastp: CBL-interacting serine/threonine-protein kinase 17 from Arabidopsis with 70.44% of identity
• Blastx: CBL-interacting serine/threonine-protein kinase 1 from Arabidopsis with 76.47% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT1G48260)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415917.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;