Transcript | Ll_transcript_446858 |
---|---|
CDS coordinates | 3-593 (+) |
Peptide sequence | QLLFINLQFPLLLDLYHSQGFTIEIRARSLFLMKPSSLFLLSFTSHRIMRSFCHPLRCLWLGAFVLRSIFASALCLNPWHIVVVMKNKNQVLEEIKTTRKISGPTAITGLLSYSRAMISMFFLCYLGEMELAGGSLSIGSANITHYSVIAGLAMGMEPICGQAYRAKQMKILGFTLQRTILLLLSTSFQCHSHGLT* |
ORF Type | 5prime_partial |
Blastp | Protein DETOXIFICATION 48 from Arabidopsis with 81.25% of identity |
---|---|
Blastx | Protein DETOXIFICATION 48 from Arabidopsis with 64.08% of identity |
Eggnog | Mate efflux family protein(COG0534) |
Kegg | Link to kegg annotations (AT1G58340) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019416038.1) |
Pfam | MatE (PF01554.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer