Protein coding transcript 112349

• Transcript: Ll_transcript_446652
• CDS coordinates: 2267-2623 (+)
• Peptide sequence: MSKVFFAGVSLFAALGFLLYGGRLFLMLQRFPVESKGRRKKLQEVGYVTTICFSCFLVRCVMMCFNAFDKAADLDVLDHPILNFIYYLSVEILPSSLVLFILRKLPPKRGISQYHPIR*
• ORF Type: complete

Annotations of Ll_transcript_446652

• Blastp: Tobamovirus multiplication protein 3 from Nicotiana with 94.07% of identity
• Blastx: Protein TOM THREE HOMOLOG 1 from Arabidopsis with 75.16% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (107769903)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464318.1)
• Pfam: Protein of unknown function (DUF1084) (PF06454.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;