Protein coding transcript 112357

• Transcript: Ll_transcript_446638
• CDS coordinates: 312-914 (+)
• Peptide sequence: MVARGVPAKTAAALAAVLFSETQSSNWWRDINDSPFWQDRIFLLLAALYGIVSAVALVQLFRIQLRVPEYGWTTQKVFHFLNFLVNGVRCSVFIFRRDVQKLQPEIVQHILLDMPSLAFFTTYALLVLFWAEIYYQARAVSTDGLRPSFYTINAVVYIVQIVLWLILWWKPVSVLVIVSKMFFAGVSLFAALAFLLYGGR*
• ORF Type: complete

Annotations of Ll_transcript_446638

• Blastp: Protein TOM THREE HOMOLOG 1 from Arabidopsis with 74.5% of identity
• Blastx: Tobamovirus multiplication protein 3 from Arabidopsis with 83.15% of identity
• Eggnog: tobamovirus multiplication(ENOG41110A4)
• Kegg: Link to kegg annotations (AT1G14530)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459951.1)
• Pfam: Protein of unknown function (DUF1084) (PF06454.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;