Protein coding transcript 112359

• Transcript: Ll_transcript_446640
• CDS coordinates: 47-700 (+)
• Peptide sequence: MEFSNWWHHINDSPFWQDRIFHLLAALYAVVAVIALVQLVRIQLRVPEYGWTTQKLFHFLNFFVNAVRCSVFIFRRDVHKLQPDIVQHILLDMPSLAFFTTYTLLVLFWAEIYYQARAVSTDGLRPSFYTINAVVYIVQIVLWLILWWKPVSVLVIVSKMFFAGVSLFAALAFLLYGGRLFLMLQRFPVESKGRRKKLQEVGYVTTICFSCFLVRCVM
• ORF Type: 3prime_partial

Annotations of Ll_transcript_446640

• Blastp: Tobamovirus multiplication protein 3 from Arabidopsis with 81.57% of identity
• Blastx: Tobamovirus multiplication protein 3 from Arabidopsis with 81.57% of identity
• Eggnog: tobamovirus multiplication(ENOG41110A4)
• Kegg: Link to kegg annotations (AT2G02180)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458728.1)
• Pfam: Protein of unknown function (DUF1084) (PF06454.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;