Protein coding transcript 112409

• Transcript: Ll_transcript_445869
• CDS coordinates: 910-1737 (+)
• Peptide sequence: MIHVVFGVLHLIVSLGLILAMDKFLKQAFVAASIKFPSALFGMFCIFSVLIILDSTVPSAAKALVNFFEPAFLFIQRWLPLFYVPSLVVLPLYVKDIPAASGIKISLIIVGGWLATLCVAGFTAIAVRKAVNTQLVDAEPMGKPSPFSTIEVWTWTAVLITSFVVALFYPTALGTSARTCLPFLLAATVLGYIVGSGLPSNVKKVFHPIICCALSADITAYAFAYLSKSGLEPVLGYYLTKVSSNPGAGDILMGFLGSVILSFAFSMFKQRKVAI*
• ORF Type: complete

Annotations of Ll_transcript_445869

• Blastp: Plastidal glycolate/glycerate translocator 1, chloroplastic from Arabidopsis with 77.7% of identity
• Blastx: Plastidal glycolate/glycerate translocator 1, chloroplastic from Arabidopsis with 74.39% of identity
• Eggnog: cytolysis(COG1346)
• Kegg: Link to kegg annotations (AT1G32080)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424215.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;