Protein coding transcript 112411

• Transcript: Ll_transcript_445856
• CDS coordinates: 886-1368 (+)
• Peptide sequence: MSGLLIDYNWTEILKRKQILREVFAGFDPNTVAKMEEKEIMEIASNKALSLADCRVRCIVDNAKCIMKIVREYGSFSSYIWGYVNHKPVINRYKYPRNVPLRTPKAEAISKDLIKRGFRFLGPIIVYSFMQAAGLTIDHVVDCYRHSECVSLAERPWRHI*
• ORF Type: complete

Annotations of Ll_transcript_445856

• Blastp: Probable GMP synthase [glutamine-hydrolyzing] from Helicobacter with 37.24% of identity
• Blastx: Probable GMP synthase [glutamine-hydrolyzing] from Helicobacter with 38.12% of identity
• Eggnog: Catalyzes the synthesis of GMP from XMP (By similarity)(COG0518)
• Kegg: Link to kegg annotations (HH_1444)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456876.1)
• Pfam: Methyladenine glycosylase (PF03352.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;