Protein coding transcript 112423

• Transcript: Ll_transcript_447274
• CDS coordinates: 517-1158 (+)
• Peptide sequence: MSRRGGSYQSDQRRDRPSPSQPTPSEVAGRGRGRGRGSSGQGRGATHAPPPVTGSPSQSPVFGSQPPVIGSSSHANVAPASSSVTLPPAASVEVAPPPPTASTSVEALTSEVTERLTLNAPAPAPAPSSSKAIRFPNRPNYGTLGKKIRIRANHFLVQVADRDLHHYDVSYTNFQNLISPKIKKLLHLFFFVYYFFSAMWFDVKIKNHGVFVAN
• ORF Type: 3prime_partial

Annotations of Ll_transcript_447274

• Blastp: Protein argonaute 5 from Arabidopsis with 38.69% of identity
• Blastx: Protein argonaute 5 from Arabidopsis with 77.5% of identity
• Eggnog: eukaryotic translation initiation factor 2c(ENOG410XP07)
• Kegg: Link to kegg annotations (AT2G27880)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453909.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;