Protein coding transcript 112462

• Transcript: Ll_transcript_446420
• CDS coordinates: 673-1131 (+)
• Peptide sequence: MGTFGYVAPEYANSGFLNEKSDVYSFGVLLVEAITGRDPVDYSRPAAEVNLVDWLKIMVGSRRAEEVVDTNIETRPSTSSLKRAILTALRCVDPYSEKRPKMSQVVRMLQSEEYPVPREDRRRRKSQAESIEMEAQKETPESKFNGRRKQGK*
• ORF Type: complete

Annotations of Ll_transcript_446420

• Blastp: Probable receptor-like protein kinase At5g18500 from Arabidopsis with 79.53% of identity
• Blastx: Probable receptor-like protein kinase At5g18500 from Arabidopsis with 82.12% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT5G18500)
• CantataDB: Link to cantataDB annotations (CNT0000557)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455736.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;