Protein coding transcript 112540

• Transcript: Ll_transcript_447912
• CDS coordinates: 2-529 (+)
• Peptide sequence: VICSDKTGTLTTNQMSVTEFFTLGGKTNSSRVISIEGTTYNPNDGGIVDWTCYNMDVNLVAMAEICAVCNDAGIYFDGRLFRATGLPTEAALKVLVEKMGIPDMKSRNKICDTQLAANNMKGCNTLKLGCCEWWNKRSKKVATLEFDRIRKSMSVIVREPDGQNRLLVKVHLSNF*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_447912

• Blastp: Calcium-transporting ATPase, endoplasmic reticulum-type from Lycopersicon with 72.78% of identity
• Blastx: Calcium-transporting ATPase, endoplasmic reticulum-type from Lycopersicon with 72.78% of identity
• Eggnog: P-type atpase(COG0474)
• Kegg: Link to kegg annotations (543554)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422322.1)
• Pfam: Cation transport ATPase (P-type) (PF13246.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;