Transcript | Ll_transcript_447962 |
---|---|
CDS coordinates | 432-764 (+) |
Peptide sequence | MASNRGQGGIQQLLAAEQEAQRIVNAAKNEKLARLKQAKEEAEKEIAEYRAQLEREFQKKVSDSSGDSGANVKRLEIETDEKIAHLKTEAGRISDDVVTMLLKYVTTVKN* |
ORF Type | complete |
Blastp | V-type proton ATPase subunit G from Citrus with 76.36% of identity |
---|---|
Blastx | V-type proton ATPase subunit G from Citrus with 76.36% of identity |
Eggnog | - |
Kegg | - |
CantataDB | Link to cantataDB annotations (CNT0001605) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019459026.1) |
Pfam | Vacuolar (H+)-ATPase G subunit (PF03179.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer