Protein coding transcript 112543

• Transcript: Ll_transcript_447962
• CDS coordinates: 432-764 (+)
• Peptide sequence: MASNRGQGGIQQLLAAEQEAQRIVNAAKNEKLARLKQAKEEAEKEIAEYRAQLEREFQKKVSDSSGDSGANVKRLEIETDEKIAHLKTEAGRISDDVVTMLLKYVTTVKN*
• ORF Type: complete

Annotations of Ll_transcript_447962

• Blastp: V-type proton ATPase subunit G from Citrus with 76.36% of identity
• Blastx: V-type proton ATPase subunit G from Citrus with 76.36% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0001605)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459026.1)
• Pfam: Vacuolar (H+)-ATPase G subunit (PF03179.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;