Transcript | Ll_transcript_447927 |
---|---|
CDS coordinates | 1-375 (+) |
Peptide sequence | CIKKYSEEDQLDVVCTVYLCSTHLSIILFVYLALIVFSPFDCRFSCLSSRCSITNTDIHLDHITTDDTEGASSAVEPECLVPIVKLNSDILETVSSNVLNEATFILTAEEQHALAATPAHPAGLH |
ORF Type | internal |
Blastp | Solute carrier family 40 member 3, chloroplastic from Arabidopsis with 42.55% of identity |
---|---|
Blastx | - |
Eggnog | solute carrier family 40 (iron-regulated transporter), member 1(ENOG410XS3F) |
Kegg | Link to kegg annotations (AT5G26820) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019428812.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer