| Transcript | Ll_transcript_447927 |
|---|---|
| CDS coordinates | 1-375 (+) |
| Peptide sequence | CIKKYSEEDQLDVVCTVYLCSTHLSIILFVYLALIVFSPFDCRFSCLSSRCSITNTDIHLDHITTDDTEGASSAVEPECLVPIVKLNSDILETVSSNVLNEATFILTAEEQHALAATPAHPAGLH |
| ORF Type | internal |
| Blastp | Solute carrier family 40 member 3, chloroplastic from Arabidopsis with 42.55% of identity |
|---|---|
| Blastx | - |
| Eggnog | solute carrier family 40 (iron-regulated transporter), member 1(ENOG410XS3F) |
| Kegg | Link to kegg annotations (AT5G26820) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019428812.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer