Protein coding transcript 11258

• Transcript: Ll_transcript_335207
• CDS coordinates: 210-512 (+)
• Peptide sequence: MAATPIAGVSYVATPVMEEEELVDGDFYLLAKSYFDCREYKRAAHVLRDQTGRKSVFLRCYALYLVCYVPPALDLTCLSVVVQHFGLISCILVYVEQRKN*
• ORF Type: complete

Annotations of Ll_transcript_335207

• Blastp: Anaphase-promoting complex subunit 8 from Arabidopsis with 68.85% of identity
• Blastx: Anaphase-promoting complex subunit 8 from Arabidopsis with 66.07% of identity
• Eggnog: cell division cycle(ENOG410XPS3)
• Kegg: Link to kegg annotations (AT3G48150)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449295.1)
• Pfam: Anaphase promoting complex subunit 8 / Cdc23 (PF04049.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;