Protein coding transcript 112584

• Transcript: Ll_transcript_448309
• CDS coordinates: 1754-2893 (+)
• Peptide sequence: MLQIQFHFLEGTRMWRRGADPDGYVANFVETEQIMQINGYTASFVQVRGSIPLLWEQIVDLTYKPKFELLKLEEAPRVLERHFLDLRKKYGAVVAVDLVNKHGGEGRLCEKFGSTMQQVASDDVRYIHFDFHHICGHVHFENLAILYDQISDFLETNGYLLLDEKGEKMKEQLGVVRTNCIDCLDRTNVTQSMIGRNMLEYQLRRLGVFGAEETISSHPNLDDSFKILWANHGDDISVQYSGTPALKGDFVRYGHRTIEGILADGWNALMRYYLNNFCDGTKQDTIDLLQGHYIVSVGRDMTPSSQNGGLEAIASFPLALGLVLIGFLFATMSLRQVRYDFRHFFFSLMWASISVGIAAFVRVNGRVFCNRPRLNKPRC*
• ORF Type: complete

Annotations of Ll_transcript_448309

• Blastp: Phosphoinositide phosphatase SAC6 from Arabidopsis with 75.54% of identity
• Blastx: Phosphoinositide phosphatase SAC6 from Arabidopsis with 75.54% of identity
• Eggnog: Phosphatase(COG5329)
• Kegg: Link to kegg annotations (AT5G66020)
• CantataDB: Link to cantataDB annotations (CNT0000925)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421966.1)
• Pfam: SacI homology domain (PF02383.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;