Protein coding transcript 112586

• Transcript: Ll_transcript_448311
• CDS coordinates: 254-952 (+)
• Peptide sequence: MWRRGADPDGYVANFVETEQIMQFNGYTASLVQVRGSIPLRWQQIVDLTYKPKFELLKLEEAPRVLERHFLDLRKKYGAVLAVDLVNKHGGEGRLCEKFGDTMQHVAGDDVRYVHFDFHQVCGHVHFERLSILYEQISDFLERNGYLLLNEKGEKMKEQLGVVRTNCIDCLDRTNVTQSMIGRNMLECQLRRLGVFGAEETISSHPNLDDSFKICKCIANPYYLHKKLVFAH*
• ORF Type: complete

Annotations of Ll_transcript_448311

• Blastp: Phosphoinositide phosphatase SAC7 from Arabidopsis with 79.91% of identity
• Blastx: Phosphoinositide phosphatase SAC7 from Arabidopsis with 79.92% of identity
• Eggnog: Phosphatase(COG5329)
• Kegg: Link to kegg annotations (AT3G51460)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424254.1)
• Pfam: SacI homology domain (PF02383.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;