Protein coding transcript 1126

• Transcript: Ll_transcript_347361
• CDS coordinates: 3-803 (+)
• Peptide sequence: PNLITKYIVGGEESPAHAFPYQVGVRAHYIGSGSNYCGGSLIAPEWVLTAAHCIRTNFASVAPDEYEVVVGAHERFGDEDTQETIKVEKAILHPGWNWMSFNNSNDIGLLKLEHPATLSDSVKIVDLPSGDLKEQSFDGWPVRISGWGLTIDGDAKSDSPTLRYANSYVISNSECQEEFREVDEAYWGVGNSSITDHNVCSSGAEGKGVGSGDSGGPMVTYAANGKPVLIGVTSSIHRDGAAAKKPSVFIRVSKYLDWIESTMNDE*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_347361

• Blastp: Chymotrypsin-like elastase family member 3B from Mus with 37.64% of identity
• Blastx: Chymotrypsin-like elastase family member 3B from Mus with 37.64% of identity
• Eggnog: protease(COG5640)
• Kegg: Link to kegg annotations (67868)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441631.1)
• Pfam: Trypsin (PF00089.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;