Protein coding transcript 11261

• Transcript: Ll_transcript_335564
• CDS coordinates: 97-798 (+)
• Peptide sequence: MASQSSKAKLADLKERFGREIRVFETSVLSPSSNAASSNGEETDDFYEFTSEDYFRILATKKEDKFLKTRKLREADEKSRRSKITKAVIRVRFPDNHTLEATFHPSETIQSLIDLLNKVIAQPGQPYYIYTTPPKKVVNDLSQDFYTAGFCPGAIVYFSYNVPKGDSTVVDHIGHYLRDEILSLKDLDVSNDEGQQSEPEQPAPEPAEATRRPPIEERKPAEKKLVKPKWLKM*
• ORF Type: complete

Annotations of Ll_transcript_335564

• Blastp: Plant UBX domain-containing protein 1 from Arabidopsis with 59.83% of identity
• Blastx: Plant UBX domain-containing protein 1 from Arabidopsis with 57.65% of identity
• Eggnog: alveolar soft part sarcoma chromosome region, candidate 1(ENOG410XQQK)
• Kegg: Link to kegg annotations (AT3G27310)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458026.1)
• Pfam: UBX domain (PF00789.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;