Protein coding transcript 1127

• Transcript: Ll_transcript_347383
• CDS coordinates: 1-711 (+)
• Peptide sequence: NKSMLVSNCIFRMGGAAILLSNFYSHSHPSKYLLSHTLRTNKASQDDCFNSIMQREDETNTTGISLSLDLIRSASRETIRSNISILGKFVLPFKEQIKFLASLVGIKYLKISMKRPYNPDFKLAFEHFCVHTGAKEIQDVLKEVLQLNDYHLEPSKMTLHRFGNTSSSSVWYVLAYCEAKGRIRKGDRMWQLSFGAGFKCNSAVWRALRTIDPAKETNPWTDEIHHFPVDVSALYK*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_347383

• Blastp: 3-ketoacyl-CoA synthase 2 from Arabidopsis with 59.07% of identity
• Blastx: 3-ketoacyl-CoA synthase 2 from Arabidopsis with 59.07% of identity
• Eggnog: 3-ketoacyl-coa synthase(ENOG410Y5VH)
• Kegg: Link to kegg annotations (AT1G04220)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460038.1)
• Pfam: FAE1/Type III polyketide synthase-like protein (PF08392.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;