Protein coding transcript 11270

• Transcript: Ll_transcript_335316
• CDS coordinates: 354-1586 (+)
• Peptide sequence: MVAAVNVSRFEGIPMAPPDPILGVSEAFRADTSDAKLNLGVGAYRTEELQPYVLKVVNKAENLMLERGENKEYLAIEGLAAFNKATAELLLGADNPAIKEQRVATVQGLSGTGSLRLGAALIERYFPGAKVLISAPTWGNHKNIFNDAKVPWSEYRYYDPKTVGLDFEGMIEDIKAAPEGTFVLLHGCAHNPTGIDPTLEQWEKIADVIQEKNHIPFFDVAYQGFASGSLDEDAASVRLFVSRGLEVLVAQSYSKNLGLYAERIGAINVISSSPESAVRVKSQLKRIARPMYSNPPVHGARIVADIVGNPALFDEWKVEMEMMAGRIKNVRQQLYDSISSKDKSGKDWSFILKQIGMFSYTGLNKNQSDNMTNKWHVYMTKDGRISLAGLSLAKCEYLADAIIDSFHNVS*
• ORF Type: complete

Annotations of Ll_transcript_335316

• Blastp: Aspartate aminotransferase P2, mitochondrial from Lupinus with 98.29% of identity
• Blastx: Aspartate aminotransferase P2, mitochondrial from Lupinus with 97.27% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438784.1)
• Pfam: Aminotransferase class I and II (PF00155.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;